PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_04651.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GeBP
Protein Properties Length: 389aa    MW: 43219.6 Da    PI: 6.2581
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_04651.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573127.17.8e-40167263298
                   DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqk 87 
                              lfqrlwse+Dei++L+G+id+++k++++p++d++af+ef+kks++++vsksql +KirrLKkK++++  k k+gke +fsk+h+qk
  Sme2.5_04651.1_g00003.1 167 LFQRLWSEDDEIAILKGMIDYRSKKKADPVADLSAFHEFIKKSLHVDVSKSQLQDKIRRLKKKYENNAGKEKKGKERTFSKPHEQK 252
                              79************************************************************************************ PP

                   DUF573  88 ifelskkiWgs 98 
                               +elskkiWg+
  Sme2.5_04651.1_g00003.1 253 GYELSKKIWGK 263
                              *********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.6E-36168262IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MAKNRPEEEE GESGEEMEVS SQEKADTESD SELESESEPE QEQPPKKPPV AAPKKPQPQD  60
SASSTEEESD SESEPETQKP NPVVKPIASK PMDEPKKAAP TAEKKSRSKA DATAKFISPK  120
KSAPVVGAKR PVDDGEAKES KRSKKKPEKE IETPVKKTPT DDVKRQLFQR LWSEDDEIAI  180
LKGMIDYRSK KKADPVADLS AFHEFIKKSL HVDVSKSQLQ DKIRRLKKKY ENNAGKEKKG  240
KERTFSKPHE QKGYELSKKI WGKEKSDKVQ EEVVKVENVT SSKGQSNSGS KDDGVLVVVK  300
VDKPSTEVEK TVEVTPNLSL ISCGGSVAAL EKWLDDHSGL LSVEKRNEIE EKSTSLKVTE  360
AGFCLRRVNL IAEQGELMRE VLKAAGFEI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006363288.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLM1D1F70.0M1D1F7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000792150.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30421947
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.13e-23DNA-binding storekeeper protein-related transcriptional regulator